Lineage for d1j0bt_ (1j0b T:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2514801Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2514802Protein 1-aminocyclopropane-1-carboxylate deaminase [53694] (3 species)
  7. 2514828Species Pyrococcus horikoshii [TaxId:53953] [89777] (2 PDB entries)
  8. 2514851Domain d1j0bt_: 1j0b T: [83893]
    complexed with 5pa

Details for d1j0bt_

PDB Entry: 1j0b (more details), 2.7 Å

PDB Description: Crystal Structure Analysis of the ACC deaminase homologue complexed with inhibitor
PDB Compounds: (T:) 1-aminocyclopropane-1-carboxylate deaminase

SCOPe Domain Sequences for d1j0bt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0bt_ c.79.1.1 (T:) 1-aminocyclopropane-1-carboxylate deaminase {Pyrococcus horikoshii [TaxId: 53953]}
mhpkifallakfprvelipwetpiqylpnisreigadvyikrddltglgiggnkirkley
llgdalskgadvvitvgavhsnhafvtglaakklgldailvlrgkeelkgnylldkimgi
etrvydakdsfelmkyaeeiaeelkregrkpyvippggaspigtlgyvravgeiatqsev
kfdsivvaagsggtlaglslglsilnedirpvgiavgrfgevmtskldnlikeaaellgv
kvevrpelydysfgeygkitgevaqiirkvgtregiildpvytgkafyglvdlarkgelg
ekilfihtggisgtfhygdkllsll

SCOPe Domain Coordinates for d1j0bt_:

Click to download the PDB-style file with coordinates for d1j0bt_.
(The format of our PDB-style files is described here.)

Timeline for d1j0bt_: