Lineage for d1izja2 (1izj A:555-637)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566044Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 566045Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 566046Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 566265Protein Maltogenic amylase [51031] (4 species)
  7. 566269Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (6 PDB entries)
  8. 566274Domain d1izja2: 1izj A:555-637 [83842]
    Other proteins in same PDB: d1izja1, d1izja3
    complexed with ca; mutant

Details for d1izja2

PDB Entry: 1izj (more details), 2.2 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase 1 mutant enzyme f313a

SCOP Domain Sequences for d1izja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izja2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

SCOP Domain Coordinates for d1izja2:

Click to download the PDB-style file with coordinates for d1izja2.
(The format of our PDB-style files is described here.)

Timeline for d1izja2: