![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Maltogenic amylase [51031] (4 species) |
![]() | Species Thermoactinomyces vulgaris, TVAI [TaxId:2026] [75017] (8 PDB entries) |
![]() | Domain d1izja2: 1izj A:555-637 [83842] Other proteins in same PDB: d1izja1, d1izja3 complexed with ca; mutant |
PDB Entry: 1izj (more details), 2.2 Å
SCOPe Domain Sequences for d1izja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1izja2 b.71.1.1 (A:555-637) Maltogenic amylase {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh sytvqngmvtvavdghygavlaq
Timeline for d1izja2: