Lineage for d1iyid1 (1iyi D:676-799)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 356299Protein Class sigma GST [81351] (4 species)
  7. 356303Species Human (Homo sapiens) [TaxId:9606] [89061] (2 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 356311Domain d1iyid1: 1iyi D:676-799 [83804]
    Other proteins in same PDB: d1iyia2, d1iyib2, d1iyic2, d1iyid2
    complexed with ca, gsh

Details for d1iyid1

PDB Entry: 1iyi (more details), 1.8 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase

SCOP Domain Sequences for d1iyid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyid1 a.45.1.1 (D:676-799) Class sigma GST {Human (Homo sapiens)}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOP Domain Coordinates for d1iyid1:

Click to download the PDB-style file with coordinates for d1iyid1.
(The format of our PDB-style files is described here.)

Timeline for d1iyid1: