SCOP 1.67: Domain d1iyia1: 1iyi A:76-199

Lineage for d1iyia1 (1iyi A:76-199)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class sigma GST [81351] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89061] (2 PDB entries)
   synonym: hematopoietic prostaglandin D synthase

8. Domain d1iyia1: 1iyi A:76-199 [83798]
   Other proteins in same PDB: d1iyia2, d1iyib2, d1iyic2, d1iyid2

Details for d1iyia1

PDB Entry: 1iyi, 1.8 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase

SCOP Domain Sequences for d1iyia1:

Sequence; same for both SEQRES and ATOM records:

>d1iyia1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens)}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d1iyia1:

• d1iyia1 first appeared in SCOP 1.65
  
• d1iyia1 appears in SCOP 1.69
  
• d1iyia1 appears in the current release, SCOPe 2.08