SCOP 1.73: Domain d1iyha2: 1iyh A:2-75

Lineage for d1iyha2 (1iyh A:2-75)

Root: SCOP 1.73
Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (22 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
Protein Class sigma GST [81362] (5 species)
Species Human (Homo sapiens) [TaxId:9606] [89705] (4 PDB entries)
synonym: hematopoietic prostaglandin D synthase
Domain d1iyha2: 1iyh A:2-75 [83791]
Other proteins in same PDB: d1iyha1, d1iyhb1, d1iyhc1, d1iyhd1

Details for d1iyha2

PDB Entry: 1iyh (more details), 1.7 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase

PDB Compounds: (A:) hematopoietic prostagladin d synthase

SCOP Domain Sequences for d1iyha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyha2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOP Domain Coordinates for d1iyha2:

Click to download the PDB-style file with coordinates for d1iyha2.
(The format of our PDB-style files is described here.)

Timeline for d1iyha2: