SCOP 1.65: Domain d1iu3c_: 1iu3 C:

Lineage for d1iu3c_ (1iu3 C:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.228: Replication modulator SeqA, C-terminal DNA-binding domain [82807] (1 superfamily)
   consists of seven alpha-helices and three-stranded beta-sheet

4. Superfamily d.228.1: Replication modulator SeqA, C-terminal DNA-binding domain [82808] (1 family)

5. Family d.228.1.1: Replication modulator SeqA, C-terminal DNA-binding domain [82809] (1 protein)

6. Protein Replication modulator SeqA, C-terminal DNA-binding domain [82810] (1 species)
   binds to fully methylated and hemimethylated GATC sequences at oriC

7. Species Escherichia coli [TaxId:562] [82811] (2 PDB entries)

8. Domain d1iu3c_: 1iu3 C: [83709]

Details for d1iu3c_

PDB Entry: 1iu3, 3 Å

PDB Description: crystal structure of the e.coli seqa protein complexed with hemimethylated dna

SCOP Domain Sequences for d1iu3c_:

Sequence; same for both SEQRES and ATOM records:

>d1iu3c_ d.228.1.1 (C:) Replication modulator SeqA, C-terminal DNA-binding domain {Escherichia coli}
plgsamrelllsdeyaeqkravnrfmlllstlysldaqafaeateslhgrtrvyfaadeq
tllkngnqtkpkhvpgtpywvitntntgrkcsmiehimqsmqfpaeliekvcgti

Timeline for d1iu3c_:

• d1iu3c_ is new in SCOP 1.65
  
• d1iu3c_ appears in SCOP 1.67
  
• d1iu3c_ appears in the current release, SCOPe 2.08, called d1iu3c1