Lineage for d1ii3a_ (1ii3 A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373899Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 373900Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
    barrel, closed; n=5, S=10
  6. 373901Protein Staphylococcal nuclease [50201] (1 species)
  7. 373902Species Staphylococcus aureus [TaxId:1280] [50202] (62 PDB entries)
  8. 373922Domain d1ii3a_: 1ii3 A: [83690]
    mutant

Details for d1ii3a_

PDB Entry: 1ii3 (more details), 1.72 Å

PDB Description: structure of s. nuclease quintuple mutant v23i/v66l/i72l/i92l/v99l

SCOP Domain Sequences for d1ii3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ii3a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtiklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
lenakklevefdkgqrtdkygrglaylyadgkmlnealvrqglakvayvykpnntheqhl
rkseaqakkeklniws

SCOP Domain Coordinates for d1ii3a_:

Click to download the PDB-style file with coordinates for d1ii3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ii3a_: