Class b: All beta proteins [48724] (126 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) |
Family b.82.3.2: cAMP-binding domain [51210] (3 proteins) |
Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species) |
Species Escherichia coli [TaxId:562] [51212] (14 PDB entries) |
Domain d1i5zb2: 1i5z B:1-137 [83672] Other proteins in same PDB: d1i5za1, d1i5zb1 complexed with cmp, trs |
PDB Entry: 1i5z (more details), 1.9 Å
SCOP Domain Sequences for d1i5zb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5zb2 b.82.3.2 (B:1-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli} vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm arrlqvtsekvgnlafl
Timeline for d1i5zb2: