SCOP 1.71: Domain d1i0ed1: 1i0e D:8-102

Lineage for d1i0ed1 (1i0e D:8-102)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family)

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Creatine kinase, N-domain [48036] (7 species)

7. Species Human (Homo sapiens), muscle isoform [TaxId:9606] [89088] (1 PDB entry)

8. Domain d1i0ed1: 1i0e D:8-102 [83661]
   Other proteins in same PDB: d1i0ea2, d1i0eb2, d1i0ec2, d1i0ed2

Details for d1i0ed1

PDB Entry: 1i0e, 3.5 Å

PDB Description: crystal structure of creatine kinase from human muscle

SCOP Domain Sequences for d1i0ed1:

Sequence; same for both SEQRES and ATOM records:

>d1i0ed1 a.83.1.1 (D:8-102) Creatine kinase, N-domain {Human (Homo sapiens), muscle isoform}
nkfklnykpeeeypdlskhnnhmakvltlelykklrdketpsgftvddviqtgvdnpghp
fimtvgcvagdeesyevfkelfdpiisdrhggykp

Timeline for d1i0ed1:

• d1i0ed1 first appeared in SCOP 1.65
  
• d1i0ed1 appears in SCOP 1.69
  
• d1i0ed1 appears in SCOP 1.73
  
• d1i0ed1 appears in the current release, SCOPe 2.08