Class a: All alpha proteins [46456] (226 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) |
Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
Protein Creatine kinase, N-domain [48036] (7 species) |
Species Human (Homo sapiens), muscle isoform [TaxId:9606] [89088] (1 PDB entry) |
Domain d1i0ed1: 1i0e D:8-102 [83661] Other proteins in same PDB: d1i0ea2, d1i0eb2, d1i0ec2, d1i0ed2 |
PDB Entry: 1i0e (more details), 3.5 Å
SCOP Domain Sequences for d1i0ed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i0ed1 a.83.1.1 (D:8-102) Creatine kinase, N-domain {Human (Homo sapiens), muscle isoform} nkfklnykpeeeypdlskhnnhmakvltlelykklrdketpsgftvddviqtgvdnpghp fimtvgcvagdeesyevfkelfdpiisdrhggykp
Timeline for d1i0ed1: