Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein NK cell activating receptor NKP44 [89178] (1 species) a triggering partner in natural cytotoxicity |
Species Human (Homo sapiens) [TaxId:9606] [89179] (1 PDB entry) |
Domain d1hkfa_: 1hkf A: [83553] |
PDB Entry: 1hkf (more details), 2.2 Å
SCOPe Domain Sequences for d1hkfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} skaqvlqsvagqtltvrcqypptgslyekkgwckeasalvcirlvtsskprtmawtsrft iwddpdagfftvtmtdlreedsghywcriyrpsdnsvsksvrfylvvs
Timeline for d1hkfa_: