Lineage for d1hkfa_ (1hkf A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289722Protein NK cell activating receptor NKP44 [89178] (1 species)
    a triggering partner in natural cytotoxicity
  7. 1289723Species Human (Homo sapiens) [TaxId:9606] [89179] (1 PDB entry)
  8. 1289724Domain d1hkfa_: 1hkf A: [83553]

Details for d1hkfa_

PDB Entry: 1hkf (more details), 2.2 Å

PDB Description: the three dimensional structure of nk cell receptor nkp44, a triggering partner in natural cytotoxicity
PDB Compounds: (A:) nk cell activating receptor

SCOPe Domain Sequences for d1hkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]}
skaqvlqsvagqtltvrcqypptgslyekkgwckeasalvcirlvtsskprtmawtsrft
iwddpdagfftvtmtdlreedsghywcriyrpsdnsvsksvrfylvvs

SCOPe Domain Coordinates for d1hkfa_:

Click to download the PDB-style file with coordinates for d1hkfa_.
(The format of our PDB-style files is described here.)

Timeline for d1hkfa_: