Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein) family GH67 automatically mapped to Pfam PF03648 |
Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species) inverting reaction mechanism |
Species Pseudomonas cellulosa [TaxId:155077] [82739] (5 PDB entries) |
Domain d1h41a2: 1h41 A:5-151 [83473] Other proteins in same PDB: d1h41a1, d1h41b1 complexed with co, edo, gcv; mutant |
PDB Entry: 1h41 (more details), 1.5 Å
SCOPe Domain Sequences for d1h41a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h41a2 d.92.2.2 (A:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa [TaxId: 155077]} edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv lygsfhllrliqtqhaleklslssapr
Timeline for d1h41a2: