Class b: All beta proteins [48724] (126 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (2 families) |
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (7 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
Protein 2,4-dienoyl-CoA reductase [89309] (1 species) |
Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (4 PDB entries) |
Domain d1h0kb1: 1h0k B:23-160,B:350-386 [83437] Other proteins in same PDB: d1h0ka2, d1h0kb2 complexed with gol, so4 |
PDB Entry: 1h0k (more details), 2.11 Å
SCOP Domain Sequences for d1h0kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0kb1 b.35.1.2 (B:23-160,B:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis)} mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspinpsdinqiqgvypsk pakttgfgtaepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity
Timeline for d1h0kb1: