Class b: All beta proteins [48724] (176 folds) |
Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
Superfamily b.35.1: GroES-like [50129] (3 families) |
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
Protein 2,4-dienoyl-CoA reductase [89309] (1 species) |
Species Yeast (Candida tropicalis) [TaxId:5482] [89310] (5 PDB entries) |
Domain d1gyra1: 1gyr A:23-160,A:350-386 [83386] Other proteins in same PDB: d1gyra2, d1gyrb2, d1gyrc2 complexed with gol, so4; mutant |
PDB Entry: 1gyr (more details), 2.6 Å
SCOPe Domain Sequences for d1gyra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gyra1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvnpsk pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd fiklpnpaqskangkpngXltdaksietlydgtkplhelyqdgvanskdgkqlity
Timeline for d1gyra1:
View in 3D Domains from other chains: (mouse over for more information) d1gyrb1, d1gyrb2, d1gyrc1, d1gyrc2 |