Lineage for d1guva2 (1guv A:267-334)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408694Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1408695Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1408824Protein Chitotriosidase [82628] (1 species)
  7. 1408825Species Human (Homo sapiens) [TaxId:9606] [82629] (10 PDB entries)
  8. 1408831Domain d1guva2: 1guv A:267-334 [83334]
    Other proteins in same PDB: d1guva1
    complexed with edo

Details for d1guva2

PDB Entry: 1guv (more details), 2.35 Å

PDB Description: structure of human chitotriosidase
PDB Compounds: (A:) chitotriosidase

SCOPe Domain Sequences for d1guva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guva2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwv

SCOPe Domain Coordinates for d1guva2:

Click to download the PDB-style file with coordinates for d1guva2.
(The format of our PDB-style files is described here.)

Timeline for d1guva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guva1