Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein Homoprotocatechuate 2,3-dioxygenase [89886] (2 species) |
Species Brevibacterium fuscum [TaxId:47914] [89888] (17 PDB entries) |
Domain d1f1xc1: 1f1x C:4-147 [83212] complexed with fel |
PDB Entry: 1f1x (more details), 1.6 Å
SCOPe Domain Sequences for d1f1xc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f1xc1 d.32.1.3 (C:4-147) Homoprotocatechuate 2,3-dioxygenase {Brevibacterium fuscum [TaxId: 47914]} eipkpvapapdilrcayaelvvtdlaksrnfyvdvlglhvsyedenqiylrsfeefihhn lvltkgpvaalkamafrvrtpedvdkaeayyqelgcrterrkdgfvkgigdalrvedplg fpyefffetthverlhmrydlysa
Timeline for d1f1xc1: