SCOPe 2.04: Domain d1ku2b2: 1ku2 B:93-272

Lineage for d1ku2b2 (1ku2 B:93-272)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
   multihelical; consists of a conserved 4-helical core and a variable insert subdomain

4. Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families)

5. Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)

6. Protein Sigma factor SigA [88950] (1 species)

7. Species Thermus aquaticus [TaxId:271] [88951] (1 PDB entry)

8. Domain d1ku2b2: 1ku2 B:93-272 [83099]
   Other proteins in same PDB: d1ku2a1, d1ku2b1
   complexed with so4

Details for d1ku2b2

PDB Entry: 1ku2, 2.9 Å

PDB Description: Crystal Structure of Thermus aquaticus RNA Polymerase Sigma Subunit Fragment Containing Regions 1.2 to 3.1

PDB Compounds: (B:) sigma factor sigA

SCOPe Domain Sequences for d1ku2b2:

Sequence; same for both SEQRES and ATOM records:

>d1ku2b2 a.177.1.1 (B:93-272) Sigma factor SigA {Thermus aquaticus [TaxId: 271]}
sdpvrqylheigqvplltleeeidlarkveegmeaikklseatgldqelirevvrakilg
tariqkipglkekpdpktveevdgklkslpkelkrylhiaregeaarqhlieanlrlvvs
iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart

Timeline for d1ku2b2:

• d1ku2b2 first appeared in SCOP 1.65
  
• d1ku2b2 appears in SCOPe 2.03
  
• d1ku2b2 appears in SCOPe 2.05
  
• d1ku2b2 appears in the current release, SCOPe 2.08