Lineage for d1go3e1 (1go3 E:79-184)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541517Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)
  7. 1541532Species Methanococcus jannaschii [TaxId:2190] [88671] (1 PDB entry)
  8. 1541533Domain d1go3e1: 1go3 E:79-184 [83054]
    Other proteins in same PDB: d1go3e2, d1go3f_, d1go3m2, d1go3n_
    protein/DNA complex; protein/RNA complex

Details for d1go3e1

PDB Entry: 1go3 (more details), 1.75 Å

PDB Description: structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex
PDB Compounds: (E:) DNA-directed RNA polymerase subunit e

SCOPe Domain Sequences for d1go3e1:

Sequence, based on SEQRES records: (download)

>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Methanococcus jannaschii [TaxId: 2190]}
pemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsydpkreaiigketgkvlei
gdyvrarivaislkaerkrgskialtmrqpylgklewieeekakkq

Sequence, based on observed residues (ATOM records): (download)

>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Methanococcus jannaschii [TaxId: 2190]}
pemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsydpkaiigketgkvleigd
yvrarivaislkaskialtmrqpylgklewieeekakkq

SCOPe Domain Coordinates for d1go3e1:

Click to download the PDB-style file with coordinates for d1go3e1.
(The format of our PDB-style files is described here.)

Timeline for d1go3e1: