Class b: All beta proteins [48724] (126 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein Aphthovirus (Foot-and-mouth desease virus) coat proteins [49659] (1 species) |
Species FMDV (Foot-and-mouth disease virus), strain bfs, 1860 [TaxId:12110] [49660] (4 PDB entries) |
Domain d1fmd.1: 1fmd 4:,2: [83051] |
PDB Entry: 1fmd (more details), 3.5 Å
SCOP Domain Sequences for d1fmd.1:
Sequence, based on SEQRES records: (download)
>g1fmd.1 b.121.4.1 (4:,2:) Aphthovirus (Foot-and-mouth desease virus) coat proteins {FMDV (Foot-and-mouth disease virus), strain bfs, 1860} sgntgsiinnyymqqyqnsmdtqlgdnaisggsnegstdttsthttntqnndwfsklass afsglfgallaXdkkteettlledrilttrnghttsttqssvgvtfgyataedstsgpnt saletrvhqaerffkmalfdwvpsqnfghmhkvvlphepkgvygglvksyaymrngwdve vtavgnqfnggcllvalvpemgdisdrekyqltlyphqfinprtnmtahitvpyvgvnry dqykqhrpwtlvvmvvaplttntagaqqikvyaniaptnvhvagelpske
>g1fmd.1 b.121.4.1 (4:,2:) Aphthovirus (Foot-and-mouth desease virus) coat proteins {FMDV (Foot-and-mouth disease virus), strain bfs, 1860} sgntgsiinnyymqqyqnsmdtqlgndwfsklassafsglfgallaXdkkteettlledr ilttrnghttsttqssvgvtfgyataedstsgpntsaletrvhqaerffkmalfdwvpsq nfghmhkvvlphepkgvygglvksyaymrngwdvevtavgnqfnggcllvalvpemgdis drekyqltlyphqfinprtnmtahitvpyvgvnrydqykqhrpwtlvvmvvaplttntag aqqikvyaniaptnvhvagelpske
Timeline for d1fmd.1:
View in 3D Domains from other chains: (mouse over for more information) d1fmd1_, d1fmd1_, d1fmd3_, d1fmd3_ |