SCOP 1.65: Domain d1o9la2: 1o9l A:300-520

Lineage for d1o9la2 (1o9l A:300-520)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.63: CoA transferase [53315] (1 superfamily)
   core: 3 layers: a/b/a; beta-sheet of 7 strands, order 4321567; part of sheet is folded upon itself and forms a barrel-like structure

4. Superfamily c.63.1: CoA transferase [53316] (2 families)

5. Family c.63.1.3: beta subunit-like [74657] (2 proteins)
   mixed beta-sheet; strand 3 is antiparallel to the rest

6. Protein Succinate:CoA transferase, C-terminal domain [82466] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [82467] (2 PDB entries)

8. Domain d1o9la2: 1o9l A:300-520 [81242]
   Other proteins in same PDB: d1o9la1, d1o9lb1, d1o9lc1, d1o9ld1

Details for d1o9la2

PDB Entry: 1o9l, 2.4 Å

PDB Description: succinate:coenzyme-a transferase (pig heart)

SCOP Domain Sequences for d1o9la2:

Sequence; same for both SEQRES and ATOM records:

>d1o9la2 c.63.1.3 (A:300-520) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)}
nvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnev
dadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgkl
vkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvd
rkkgltlielwegltvddikkstgcdfavspklipmqqvtt

Timeline for d1o9la2:

• d1o9la2 first appeared in SCOP 1.63
  
• d1o9la2 appears in SCOP 1.67
  
• d1o9la2 appears in the current release, SCOPe 2.08