SCOPe 2.07: Domain d1o9ba1: 1o9b A:107-287

Lineage for d1o9ba1 (1o9b A:107-287)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Putative shikimate dehydrogenase YdiB [82305] (1 species)

7. Species Escherichia coli [TaxId:562] [82306] (3 PDB entries)

8. Domain d1o9ba1: 1o9b A:107-287 [81237]
   Other proteins in same PDB: d1o9ba2, d1o9bb2
   complexed with nai, po4

Details for d1o9ba1

PDB Entry: 1o9b, 2.5 Å

PDB Description: quinate/shikimate dehydrogenase ydib complexed with nadh

PDB Compounds: (A:) hypothetical shikimate 5-dehydrogenase-like protein ydib

SCOPe Domain Sequences for d1o9ba1:

Sequence; same for both SEQRES and ATOM records:

>d1o9ba1 c.2.1.7 (A:107-287) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]}
dgtghiraikesgfdikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkala
faqrvnentdcvvtvtdladqqafaealasadiltngtkvgmkpleneslvndisllhpg
llvtecvynphmtkllqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgf
g

Timeline for d1o9ba1:

• d1o9ba1 first appeared in SCOP 1.63
  
• d1o9ba1 appears in SCOPe 2.06
  
• d1o9ba1 appears in the current release, SCOPe 2.08