SCOPe 2.07: Domain d1o94d_: 1o94 D:

Lineage for d1o94d_ (1o94 D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.3: ETFP subunits [52432] (3 proteins)
   alpha/beta heterodimer of homologous subunits; contains additional strands on both edges of the core sheet

6. Protein Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain [81393] (3 species)
   contains an additional FAD-binding domain of DHS-like fold

7. Species Methylophilus methylotrophus [TaxId:17] [82362] (8 PDB entries)

8. Domain d1o94d_: 1o94 D: [81207]
   Other proteins in same PDB: d1o94a1, d1o94a2, d1o94a3, d1o94b1, d1o94b2, d1o94b3, d1o94c_, d1o94e_
   complexed with adp, amp, fmn, sf4

Details for d1o94d_

PDB Entry: 1o94, 2 Å

PDB Description: Ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein

PDB Compounds: (D:) electron transfer flavoprotein alpha-subunit

SCOPe Domain Sequences for d1o94d_:

Sequence; same for both SEQRES and ATOM records:

>d1o94d_ c.26.2.3 (D:) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]}
skilviaehrrndlrpvsleligaanglkksgedkvvvavigsqadafvpalsvngvdel
vvvkgssidfdpdvfeasvsaliaahnpsvvllphsvdslgyasslasktgygfatdvyi
veyqgdelvatrggynqkvnvevdfpgkstvvltirpsvfkplegagspvvsnvdapsvq
srsqnkdyv

Timeline for d1o94d_:

• d1o94d_ first appeared in SCOP 1.63
  
• d1o94d_ appears in SCOPe 2.06
  
• d1o94d_ appears in the current release, SCOPe 2.08