![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (10 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein) |
![]() | Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [54440] (8 PDB entries) |
![]() | Domain d1o7nb_: 1o7n B: [81164] Other proteins in same PDB: d1o7na1, d1o7na2 complexed with edo, fe, fes, ind, oxy, so4 |
PDB Entry: 1o7n (more details), 1.4 Å
SCOP Domain Sequences for d1o7nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7nb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida} miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp erilqthnlmvfl
Timeline for d1o7nb_: