SCOP 1.67: Domain d1o7nb_: 1o7n B:

Lineage for d1o7nb_ (1o7n B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (10 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Naphthalene 1,2-dioxygenase beta subunit [54438] (1 protein)

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (1 species)

7. Species Pseudomonas putida [TaxId:303] [54440] (8 PDB entries)

8. Domain d1o7nb_: 1o7n B: [81164]
   Other proteins in same PDB: d1o7na1, d1o7na2
   complexed with edo, fe, fes, ind, oxy, so4

Details for d1o7nb_

PDB Entry: 1o7n, 1.4 Å

PDB Description: naphthalene 1,2-dioxygenase, ternary complex with dioxygen and indole

SCOP Domain Sequences for d1o7nb_:

Sequence; same for both SEQRES and ATOM records:

>d1o7nb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida}
miniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgse
vqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfit
nvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdyp
erilqthnlmvfl

Timeline for d1o7nb_:

• d1o7nb_ first appeared in SCOP 1.63
  
• d1o7nb_ appears in SCOP 1.65
  
• d1o7nb_ appears in SCOP 1.69
  
• d1o7nb_ appears in the current release, SCOPe 2.08