SCOP 1.69: Domain d1o1wa_: 1o1w A:

Lineage for d1o1wa_ (1o1w A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (80 PDB entries)

8. Domain d1o1wa_: 1o1w A: [81078]
   RNase H domain only

Details for d1o1wa_

PDB Entry: 1o1w

PDB Description: solution structure of the rnase h domain of the hiv-1 reverse transcriptase in the presence of magnesium

SCOP Domain Sequences for d1o1wa_:

Sequence; same for both SEQRES and ATOM records:

>d1o1wa_ c.55.3.1 (A:) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
mnelyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqai
ylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgi
ggneqvdklvsagirkvl

Timeline for d1o1wa_:

• d1o1wa_ first appeared in SCOP 1.63
  
• d1o1wa_ appears in SCOP 1.67
  
• d1o1wa_ appears in SCOP 1.71
  
• d1o1wa_ appears in the current release, SCOPe 2.08, called d1o1wa1