PDB entry 1o1w

View 1o1w on RCSB PDB site
Description: solution structure of the rnase h domain of the hiv-1 reverse transcriptase in the presence of magnesium
Deposited on 2003-02-12, released 2003-02-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-02-18, with a file datestamp of 2003-02-18.
Experiment type: NMR7
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1o1wa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1o1wA (A:)
  mnelyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqai
  ylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgi
  ggneqvdklvsagirkvl