Lineage for d1o0wb2 (1o0w B:168-237)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412075Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 1412076Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 1412077Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 1412103Protein RNase III, C-terminal domain [54776] (3 species)
  7. 1412129Species Thermotoga maritima [TaxId:2336] [82644] (1 PDB entry)
  8. 1412131Domain d1o0wb2: 1o0w B:168-237 [80754]
    Other proteins in same PDB: d1o0wa1, d1o0wb1
    CASP5

Details for d1o0wb2

PDB Entry: 1o0w (more details), 2 Å

PDB Description: crystal structure of ribonuclease iii (tm1102) from thermotoga maritima at 2.0 a resolution
PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1o0wb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0wb2 d.50.1.1 (B:168-237) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
dyktalqeivqsehkvppeyilvrtekndgdrifvvevrvngktiatgkgrtkkeaekea
ariayekllk

SCOPe Domain Coordinates for d1o0wb2:

Click to download the PDB-style file with coordinates for d1o0wb2.
(The format of our PDB-style files is described here.)

Timeline for d1o0wb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o0wb1