Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
Protein Putative shikimate dehydrogenase YdiB [82305] (1 species) |
Species Escherichia coli [TaxId:562] [82306] (3 PDB entries) |
Domain d1npdb1: 1npd B:107-288 [80683] Other proteins in same PDB: d1npda2, d1npdb2 structural genomics complexed with nad |
PDB Entry: 1npd (more details), 2.3 Å
SCOPe Domain Sequences for d1npdb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npdb1 c.2.1.7 (B:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} dgtghiraikesgfdikgktmvllgaggastaigaqgaieglkeiklfnrrdeffdkala faqrvnentdcvvtvtdladqqafaealasadiltngtkvgmkpleneslvndisllhpg llvtecvynphmtkllqqaqqagcktidgygmllwqgaeqftlwtgkdfpleyvkqvmgf ga
Timeline for d1npdb1: