SCOPe 2.07: Domain d1nm2a2: 1nm2 A:134-195

Lineage for d1nm2a2 (1nm2 A:134-195)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.23: Probable ACP-binding domain of malonyl-CoA ACP transacylase [55048] (1 family)

5. Family d.58.23.1: Probable ACP-binding domain of malonyl-CoA ACP transacylase [55049] (2 proteins)

6. Protein Probable ACP-binding domain of malonyl-CoA ACP transacylase [55050] (2 species)

7. Species Streptomyces coelicolor A3(2) [TaxId:100226] [82687] (1 PDB entry)

8. Domain d1nm2a2: 1nm2 A:134-195 [80655]
   Other proteins in same PDB: d1nm2a1, d1nm2a3
   complexed with acy, ni

Details for d1nm2a2

PDB Entry: 1nm2, 2 Å

PDB Description: malonyl-coa:acp transacylase

PDB Compounds: (A:) malonyl CoA:acyl carrier protein malonyltransferase

SCOPe Domain Sequences for d1nm2a2:

Sequence; same for both SEQRES and ATOM records:

>d1nm2a2 d.58.23.1 (A:134-195) Probable ACP-binding domain of malonyl-CoA ACP transacylase {Streptomyces coelicolor A3(2) [TaxId: 100226]}
etgmsallggdpevsvahlerlgltpanvngagqivaagtmeqlaalnedkpegvrkvvp
lk

Timeline for d1nm2a2:

• d1nm2a2 first appeared in SCOP 1.63
  
• d1nm2a2 appears in SCOPe 2.06
  
• d1nm2a2 appears in the current release, SCOPe 2.08