SCOP 1.73: Domain d1nhea_: 1nhe A:

Lineage for d1nhea_ (1nhe A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.2: C-type lysozyme [53960] (2 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries)

8. Domain d1nhea_: 1nhe A: [80512]
   Other proteins in same PDB: d1nheb_, d1nhed_

Details for d1nhea_

PDB Entry: 1nhe, 2.5 Å

PDB Description: Crystal structure of Lactose synthase complex with UDP

PDB Compounds: (A:) alpha-lactalbumin

SCOP Domain Sequences for d1nhea_:

Sequence; same for both SEQRES and ATOM records:

>d1nhea_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

Timeline for d1nhea_:

• d1nhea_ first appeared in SCOP 1.63
  
• d1nhea_ appears in SCOP 1.71
  
• d1nhea_ appears in SCOP 1.75
  
• d1nhea_ appears in the current release, SCOPe 2.08