Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (7 families) |
Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
Protein alpha-Lactalbumin [53975] (6 species) expressed only in the lactating mammary gland, strongly binds calcium ion |
Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries) |
Domain d1nhea_: 1nhe A: [80512] Other proteins in same PDB: d1nheb_, d1nhed_ |
PDB Entry: 1nhe (more details), 2.5 Å
SCOP Domain Sequences for d1nhea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nhea_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]} teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc ekp
Timeline for d1nhea_: