Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (2 families) |
Family d.42.1.2: Tetramerization domain of potassium channels [54701] (6 proteins) |
Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [82639] (1 species) Suppressor of kinetochore protein 1,Scskp1 |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82640] (1 PDB entry) |
Domain d1nexa2: 1nex A:4-103 [80442] Other proteins in same PDB: d1nexa1, d1nexb1, d1nexb2, d1nexc1, d1nexd1, d1nexd2 |
PDB Entry: 1nex (more details), 2.7 Å
SCOP Domain Sequences for d1nexa2:
Sequence, based on SEQRES records: (download)
>d1nexa2 d.42.1.2 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae)} snvvlvsgegerftvdkkiaerslllknylndmgddddedddeivmpvpnvrssvlqkvi ewaehhrdsnfp
>d1nexa2 d.42.1.2 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae)} snvvlvsgegerftvdkkiaerslllknylivmpvpnvrssvlqkviewaehhrdsnfp
Timeline for d1nexa2: