SCOPe 2.03: Domain d1nenb1: 1nen B:107-238

Lineage for d1nenb1 (1nen B:107-238)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)

6. Protein Succinate dehydogenase [81669] (1 species)

7. Species Escherichia coli [TaxId:562] [81670] (6 PDB entries)

8. Domain d1nenb1: 1nen B:107-238 [80436]
   Other proteins in same PDB: d1nena1, d1nena2, d1nena3, d1nenb2, d1nenc_, d1nend_
   complexed with ca, cdn, dnt, eph, f3s, fad, fes, hem, oaa, sf4

Details for d1nenb1

PDB Entry: 1nen, 2.9 Å

PDB Description: Complex II (Succinate Dehydrogenase) From E. Coli with Dinitrophenol-17 inhibitor co-crystallized at the ubiquinone binding site

PDB Compounds: (B:) Succinate dehydrogenase iron-sulfur protein

SCOPe Domain Sequences for d1nenb1:

Sequence; same for both SEQRES and ATOM records:

>d1nenb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

Timeline for d1nenb1:

• d1nenb1 first appeared in SCOP 1.63
  
• d1nenb1 appears in SCOPe 2.02
  
• d1nenb1 appears in SCOPe 2.04
  
• d1nenb1 appears in the current release, SCOPe 2.08