SCOP 1.63: Domain d1n9pa_: 1n9p A:

Lineage for d1n9pa_ (1n9p A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (17 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of the G protein-gated inward rectifier Girk1 [81966] (1 protein)

6. Protein Cytoplasmic domain of the G protein-gated inward rectifier Girk1 [81967] (1 species)
   forms tetrameric cytoplasmic pore; contains a C-terminal extension

7. Species Mouse (Mus musculus) [TaxId:10090] [81968] (1 PDB entry)

8. Domain d1n9pa_: 1n9p A: [80343]
   complexed with mse

Details for d1n9pa_

PDB Entry: 1n9p, 1.8 Å

PDB Description: crystal structure of the cytoplasmic domain of g-protein activated inward rectifier potassium channel 1

SCOP Domain Sequences for d1n9pa_:

Sequence, based on SEQRES records:

>d1n9pa_ b.1.18.16 (A:) Cytoplasmic domain of the G protein-gated inward rectifier Girk1 {Mouse (Mus musculus)}
rqrfvdkngrcnvqhgnlgseraetlmfsehavismrdgkltlmfrvgnlrnshmvsaqi
rckllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsm
qteqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhat
fevptppysvkeqeemllmssp

Sequence, based on observed residues (ATOM records):

>d1n9pa_ b.1.18.16 (A:) Cytoplasmic domain of the G protein-gated inward rectifier Girk1 {Mouse (Mus musculus)}
rqrfvdkngrcnvqheraetlmfsehavismrdgkltlmfrvgnlrnshmvsaqirckll
ksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsmqteqf
evvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhatfevpt
ppysvkeqeemllmssp

Timeline for d1n9pa_:

• d1n9pa_ is new in SCOP 1.63
  
• d1n9pa_ appears in SCOP 1.65
  
• d1n9pa_ appears in the current release, SCOPe 2.08