Lineage for d1n8o.1 (1n8o A:,B:,C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1545556Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 1545557Species Cow (Bos taurus) [TaxId:9913] [50523] (59 PDB entries)
    Uniprot P00766
  8. 1545604Domain d1n8o.1: 1n8o A:,B:,C: [80302]
    Other proteins in same PDB: d1n8oe_

Details for d1n8o.1

PDB Entry: 1n8o (more details), 2 Å

PDB Description: crystal structure of a complex between bovine chymotrypsin and ecotin
PDB Compounds: (A:) Chymotrypsin A, A chain, (B:) Chymotrypsin A, b chain, (C:) Chymotrypsin A, C chain

SCOPe Domain Sequences for d1n8o.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1n8o.1 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

SCOPe Domain Coordinates for d1n8o.1:

Click to download the PDB-style file with coordinates for d1n8o.1.
(The format of our PDB-style files is described here.)

Timeline for d1n8o.1: