Lineage for d1n86e2 (1n86 E:151-199)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2644538Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2644539Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2644604Protein Fibrinogen beta chain [88892] (4 species)
  7. 2644613Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
    Uniprot P02675
  8. 2644637Domain d1n86e2: 1n86 E:151-199 [80284]
    Other proteins in same PDB: d1n86a_, d1n86b1, d1n86c1, d1n86c2, d1n86d_, d1n86e1, d1n86f1, d1n86f2
    coiled-coil region only
    complexed with ca, man, ndg

Details for d1n86e2

PDB Entry: 1n86 (more details), 3.2 Å

PDB Description: crystal structure of human d-dimer from cross-linked fibrin complexed with gpr and ghrpldk peptide ligands.
PDB Compounds: (E:) Fibrin beta chain

SCOPe Domain Sequences for d1n86e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n86e2 h.1.8.1 (E:151-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
lyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOPe Domain Coordinates for d1n86e2:

Click to download the PDB-style file with coordinates for d1n86e2.
(The format of our PDB-style files is described here.)

Timeline for d1n86e2: