Lineage for d1n6ec2 (1n6e C:39-319)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2418005Superfamily b.68.7: Tricorn protease N-terminal domain [69304] (1 family) (S)
    possibly related to the second domain of tricorn protease (a distorted 7-bladed beta-propeller)
  5. 2418006Family b.68.7.1: Tricorn protease N-terminal domain [69305] (1 protein)
  6. 2418007Protein Tricorn protease N-terminal domain [69306] (1 species)
  7. 2418008Species Thermoplasma acidophilum [TaxId:2303] [69307] (4 PDB entries)
  8. 2418016Domain d1n6ec2: 1n6e C:39-319 [80154]
    Other proteins in same PDB: d1n6ea1, d1n6ea3, d1n6ea4, d1n6ec1, d1n6ec3, d1n6ec4, d1n6ee1, d1n6ee3, d1n6ee4, d1n6eg1, d1n6eg3, d1n6eg4, d1n6ei1, d1n6ei3, d1n6ei4, d1n6ek1, d1n6ek3, d1n6ek4
    complexed with chm

Details for d1n6ec2

PDB Entry: 1n6e (more details), 2.6 Å

PDB Description: tricorn protease in complex with a tridecapeptide chloromethyl ketone derivative
PDB Compounds: (C:) tricorn protease

SCOPe Domain Sequences for d1n6ec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n6ec2 b.68.7.1 (C:39-319) Tricorn protease N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
mpnlllnpdihgdriifvccddlwehdlksgstrkivsnlgvinnarffpdgrkiairvm
rgsslntadlyfyngengeikrityfsgkstgrrmftdvagfdpdgnliistdamqpfss
mtclyrvendginfvplnlgpathilfadgrrvigrntfelphwkgyrggtrgkiwievn
sgafkkivdmsthvsspvivghriyfitdidgfgqiystdldgkdlrkhtsftdyyprhl
ntdgrrilfskggsiyifnpdtekiekieigdlespedrii

SCOPe Domain Coordinates for d1n6ec2:

Click to download the PDB-style file with coordinates for d1n6ec2.
(The format of our PDB-style files is described here.)

Timeline for d1n6ec2: