Lineage for d1n5we1 (1n5w E:15-146)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647036Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1647037Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 1647038Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 1647060Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 1647066Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [54673] (5 PDB entries)
  8. 1647076Domain d1n5we1: 1n5w E:15-146 [80053]
    Other proteins in same PDB: d1n5wa1, d1n5wa2, d1n5wb2, d1n5wc1, d1n5wc2, d1n5wd1, d1n5wd2, d1n5we2, d1n5wf1, d1n5wf2
    complexed with cum, fad, fes, mcn, po4

Details for d1n5we1

PDB Entry: 1n5w (more details), 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form
PDB Compounds: (E:) Carbon monoxide dehydrogenase large chain

SCOPe Domain Sequences for d1n5we1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5we1 d.41.1.1 (E:15-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
aeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariksidtskaka
lpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdryvaadaie
lvevdyeplpvl

SCOPe Domain Coordinates for d1n5we1:

Click to download the PDB-style file with coordinates for d1n5we1.
(The format of our PDB-style files is described here.)

Timeline for d1n5we1: