Lineage for d1n54a1 (1n54 A:24-290)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 284904Superfamily a.118.1: ARM repeat [48371] (13 families) (S)
  5. 284957Family a.118.1.2: HEAT repeat [48385] (3 proteins)
    this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain
  6. 284958Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
    contains three domains of this fold connected with long linkers
  7. 284959Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)
  8. 284984Domain d1n54a1: 1n54 A:24-290 [80003]
    Other proteins in same PDB: d1n54b_

Details for d1n54a1

PDB Entry: 1n54 (more details), 2.72 Å

PDB Description: Cap Binding Complex m7GpppG free

SCOP Domain Sequences for d1n54a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n54a1 a.118.1.2 (A:24-290) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens)}
anetedhleslickvgeksacslesnleglagvleadlpnykskilrllctvarllpekl
tiyttlvgllnarnynfggefveamirqlkeslkannyneavylvrflsdlvnchviaap
smvamfenfvsvtqeedvpqvrrdwyvyaflsslpwvgkelyekkdaemdrifantesyl
krrqkthvpmlqvwtadkphpqeeyldclwaqiqklkkdrwqerhilrpylafdsilcea
lqhnlppftppphtedsvypmprvifr

SCOP Domain Coordinates for d1n54a1:

Click to download the PDB-style file with coordinates for d1n54a1.
(The format of our PDB-style files is described here.)

Timeline for d1n54a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1n54b_