Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64275] (6 PDB entries) |
Domain d1n52b_: 1n52 B: [80002] Other proteins in same PDB: d1n52a1, d1n52a2, d1n52a3 complexed with gol, gtg, mg, pg4 |
PDB Entry: 1n52 (more details), 2.11 Å
SCOP Domain Sequences for d1n52b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n52b_ d.58.7.1 (B:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} lkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsksgd ikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegrqy grgrsggqvrdeyrqdydagrggygkla
Timeline for d1n52b_: