Class a: All alpha proteins [46456] (284 folds) |
Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) |
Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
Protein Ribosomal protein S7 [47975] (4 species) |
Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries) Uniprot P17291 |
Domain d1n34g_: 1n34 G: [79920] Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_ complexed with zn |
PDB Entry: 1n34 (more details), 3.8 Å
SCOP Domain Sequences for d1n34g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n34g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]} arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria helmdaaegkggavkkkedvermaeanrayahyrw
Timeline for d1n34g_: