Lineage for d1n34g_ (1n34 G:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772539Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 772540Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 772541Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 772542Protein Ribosomal protein S7 [47975] (4 species)
  7. 772572Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 772603Domain d1n34g_: 1n34 G: [79920]
    Other proteins in same PDB: d1n34b_, d1n34c1, d1n34c2, d1n34d_, d1n34e1, d1n34e2, d1n34f_, d1n34h_, d1n34i_, d1n34j_, d1n34k_, d1n34l_, d1n34m_, d1n34n_, d1n34o_, d1n34p_, d1n34q_, d1n34r_, d1n34s_, d1n34t_, d1n34v_
    complexed with zn

Details for d1n34g_

PDB Entry: 1n34 (more details), 3.8 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
PDB Compounds: (G:) 30S ribosomal protein S7

SCOP Domain Sequences for d1n34g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n34g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1n34g_:

Click to download the PDB-style file with coordinates for d1n34g_.
(The format of our PDB-style files is described here.)

Timeline for d1n34g_: