Class a: All alpha proteins [46456] (290 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) |
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
Protein Ribosomal protein S15 [47065] (3 species) |
Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) Uniprot P80378 |
Domain d1n33o_: 1n33 O: [79906] Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_ complexed with mg, par, zn |
PDB Entry: 1n33 (more details), 3.35 Å
SCOPe Domain Sequences for d1n33o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n33o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d1n33o_: