Lineage for d1n33o_ (1n33 O:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697722Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2697723Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2697777Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 2697778Protein Ribosomal protein S15 [47065] (3 species)
  7. 2697792Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 2697815Domain d1n33o_: 1n33 O: [79906]
    Other proteins in same PDB: d1n33b_, d1n33c1, d1n33c2, d1n33d_, d1n33e1, d1n33e2, d1n33f_, d1n33g_, d1n33h_, d1n33i_, d1n33j_, d1n33k_, d1n33l_, d1n33m_, d1n33n_, d1n33p_, d1n33q_, d1n33r_, d1n33s_, d1n33t_, d1n33v_
    complexed with mg, par, zn

Details for d1n33o_

PDB Entry: 1n33 (more details), 3.35 Å

PDB Description: Structure of the Thermus thermophilus 30S ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1n33o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n33o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d1n33o_:

Click to download the PDB-style file with coordinates for d1n33o_.
(The format of our PDB-style files is described here.)

Timeline for d1n33o_: