Lineage for d1mwtb2 (1mwt B:139-327)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610396Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 2610397Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 2610398Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
    contains an insert subdomain of ClpS-like fold
  6. 2610399Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
    the insert subdomain (residues 168-239) is fully ordered
  7. 2610400Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
    Uniprot O54286 27-668
  8. 2610412Domain d1mwtb2: 1mwt B:139-327 [79602]
    Other proteins in same PDB: d1mwta1, d1mwta3, d1mwtb1, d1mwtb3
    complexed with cd, cl

Details for d1mwtb2

PDB Entry: 1mwt (more details), 2.45 Å

PDB Description: structure of penicillin g acyl-penicillin binding protein 2a from methicillin resistant staphylococcus aureus strain 27r at 2.45 a resolution.
PDB Compounds: (B:) penicillin-binding protein 2a

SCOPe Domain Sequences for d1mwtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwtb2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOPe Domain Coordinates for d1mwtb2:

Click to download the PDB-style file with coordinates for d1mwtb2.
(The format of our PDB-style files is described here.)

Timeline for d1mwtb2: