Lineage for d1mwsa1 (1mws A:27-138)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599696Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 599942Superfamily d.17.4: NTF2-like [54427] (12 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 600090Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
    some sequence similarity to KSI
  6. 600091Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)
  7. 600092Species Staphylococcus aureus [TaxId:1280] [82597] (5 PDB entries)
  8. 600093Domain d1mwsa1: 1mws A:27-138 [79592]
    Other proteins in same PDB: d1mwsa2, d1mwsa3, d1mwsb2, d1mwsb3

Details for d1mwsa1

PDB Entry: 1mws (more details), 2 Å

PDB Description: Structure of nitrocefin acyl-Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 2.00 A resolution.

SCOP Domain Sequences for d1mwsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwsa1 d.17.4.5 (A:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOP Domain Coordinates for d1mwsa1:

Click to download the PDB-style file with coordinates for d1mwsa1.
(The format of our PDB-style files is described here.)

Timeline for d1mwsa1: