SCOP 1.65: Domain d1mw0a1: 1mw0 A:555-628

Lineage for d1mw0a1 (1mw0 A:555-628)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Amylosucrase [69328] (1 species)

7. Species Neisseria polysaccharea [TaxId:489] [69329] (8 PDB entries)

8. Domain d1mw0a1: 1mw0 A:555-628 [79549]
   Other proteins in same PDB: d1mw0a2
   complexed with dtt, glc; mutant

Details for d1mw0a1

PDB Entry: 1mw0, 2.01 Å

PDB Description: amylosucrase mutant e328q co-crystallized with maltoheptaose then soaked with maltoheptaose.

SCOP Domain Sequences for d1mw0a1:

Sequence; same for both SEQRES and ATOM records:

>d1mw0a1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

Timeline for d1mw0a1:

• d1mw0a1 first appeared in SCOP 1.63
  
• d1mw0a1 appears in SCOP 1.67
  
• d1mw0a1 appears in the current release, SCOPe 2.08