| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
| Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
| Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries) Uniprot P20701 153-334 |
| Domain d1mq8d_: 1mq8 D: [79410] Other proteins in same PDB: d1mq8a1, d1mq8a2, d1mq8c1, d1mq8c2 complex with ICAM-1 complexed with mg, nag |
PDB Entry: 1mq8 (more details), 3.3 Å
SCOPe Domain Sequences for d1mq8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mq8d_ c.62.1.1 (D:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
vdlvflfdgsmslqpdefqkildfmkdvmkkcsntsyqfaavqfstsyktefdfsdyvkr
kdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgnid
aakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlctelqkki
Timeline for d1mq8d_: