SCOP 1.75: Domain d1mq1a_: 1mq1 A:

Lineage for d1mq1a_ (1mq1 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (1 protein)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (4 PDB entries)

8. Domain d1mq1a_: 1mq1 A: [79392]
   complex with high-affinity target peptide trtk-12, chains C and D

Details for d1mq1a_

PDB Entry: 1mq1

PDB Description: ca2+-s100b-trtk-12 complex

PDB Compounds: (A:) S-100 protein, beta chain

SCOP Domain Sequences for d1mq1a_:

Sequence; same for both SEQRES and ATOM records:

>d1mq1a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dndgdgecdfqefmafvamvttacheffehe

Timeline for d1mq1a_:

• d1mq1a_ first appeared in SCOP 1.63
  
• d1mq1a_ appears in SCOP 1.73
  
• d1mq1a_ appears in SCOPe 2.01
  
• d1mq1a_ appears in the current release, SCOPe 2.08