Lineage for d1mkga_ (1mkg A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 522937Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 522938Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 522939Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 522951Protein Vascular endothelial growth factor, VEGF [57505] (1 species)
  7. 522952Species Human (Homo sapiens) [TaxId:9606] [57506] (13 PDB entries)
  8. 522986Domain d1mkga_: 1mkg A: [79234]

Details for d1mkga_

PDB Entry: 1mkg (more details), 2.5 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c57a and c102a)

SCOP Domain Sequences for d1mkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkga_ g.17.1.1 (A:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens)}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmraggccndeglecvptee
snitmqimrikphqgqhigemsflqhnkaecrpk

SCOP Domain Coordinates for d1mkga_:

Click to download the PDB-style file with coordinates for d1mkga_.
(The format of our PDB-style files is described here.)

Timeline for d1mkga_: