SCOPe 2.04: Domain d1mj1o_: 1mj1 O:

Lineage for d1mj1o_ (1mj1 O:)

1. Root: SCOPe 2.04

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1mj1o_: 1mj1 O: [79179]
   Fitting the ternary complex of EF-TU/tRNA/GTP in the cryo-EM map
   protein/RNA complex

Details for d1mj1o_

PDB Entry: 1mj1, 13 Å

PDB Description: fitting the ternary complex of ef-tu/trna/gtp and ribosomal proteins into a 13 a cryo-em map of the coli 70s ribosome

PDB Compounds: (O:) S12 ribosomal protein

SCOPe Domain Sequences for d1mj1o_:

Sequence; same for both SEQRES and ATOM records:

>d1mj1o_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

Timeline for d1mj1o_:

• d1mj1o_ first appeared in SCOP 1.63
  
• d1mj1o_ appears in SCOPe 2.03
  
• d1mj1o_ appears in SCOPe 2.05
  
• d1mj1o_ appears in the current release, SCOPe 2.08