Lineage for d1mivb1 (1miv B:140-404)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735849Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
    multihelical; can be divided into three subdomains (neck, body and tail)
  4. 2735850Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family) (S)
    the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like
  5. 2735851Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
    the 'neck' domain corresponds to the C-terminal part of Pfam PF01743
  6. 2735856Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species)
  7. 2735857Species Bacillus stearothermophilus [TaxId:1422] [81894] (3 PDB entries)
  8. 2735861Domain d1mivb1: 1miv B:140-404 [79160]
    Other proteins in same PDB: d1miva2, d1mivb2
    complexed with mg

Details for d1mivb1

PDB Entry: 1miv (more details), 3.5 Å

PDB Description: Crystal structure of Bacillus stearothermophilus CCA-adding enzyme
PDB Compounds: (B:) tRNA CCA-adding enzyme

SCOPe Domain Sequences for d1mivb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mivb1 a.173.1.1 (B:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus [TaxId: 1422]}
iirtvgeaekrfredalrmmravrfvselgfalapdteqaivqnapllahisvermtmem
ekllggpfaaralpllaetglnaylpglagkekqlrlaaayrwpwlaareerwallchal
gvqesrpflrawklpnkvvdeagailtaladiprpeawtneqlfsagleralsvetvraa
ftgappgpwheklrrrfaslpiktkgelavngkdviewvgkpagpwvkealdaiwravvn
gevenekeriyawlmernrtreknc

SCOPe Domain Coordinates for d1mivb1:

Click to download the PDB-style file with coordinates for d1mivb1.
(The format of our PDB-style files is described here.)

Timeline for d1mivb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mivb2