Lineage for d1miva2 (1miv A:1-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007199Family d.218.1.4: Poly A polymerase head domain-like [82661] (2 proteins)
    overlaps with the N-terminal part of Pfam PF01743; this family is distinct from eukaryotic PAPs
    insert X in the core is an alpha-beta(2) unit; contains two extra C-terminal strands; mixed 7-stranded sheet, order: 7612543
  6. 3007204Protein tRNA CCA-adding enzyme, head domain [82662] (2 species)
  7. 3007205Species Bacillus stearothermophilus [TaxId:1422] [82663] (3 PDB entries)
  8. 3007208Domain d1miva2: 1miv A:1-139 [79159]
    Other proteins in same PDB: d1miva1, d1mivb1
    complexed with mg

Details for d1miva2

PDB Entry: 1miv (more details), 3.5 Å

PDB Description: Crystal structure of Bacillus stearothermophilus CCA-adding enzyme
PDB Compounds: (A:) tRNA CCA-adding enzyme

SCOPe Domain Sequences for d1miva2:

Sequence, based on SEQRES records: (download)

>d1miva2 d.218.1.4 (A:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus [TaxId: 1422]}
mkppfqealgiiqqlkqhgydayfvggavrdlllgrpigdvdiatsalpedvmaifpkti
dvgskhgtvvvvhkgkayevttfktdgdyedyrrpesvtfvrsleedlkrrdftmnaiam
deygtiidpfggreairrr

Sequence, based on observed residues (ATOM records): (download)

>d1miva2 d.218.1.4 (A:1-139) tRNA CCA-adding enzyme, head domain {Bacillus stearothermophilus [TaxId: 1422]}
mkppfqealgiiqqlkqhgydayfvggavrdlllgrpigdvdiatsalpedvmaifpkti
dvgskhgtvvvvhkgkayevttfktdgsvtfvrsleedlkrrdftmnaiamdeygtiidp
fggreairrr

SCOPe Domain Coordinates for d1miva2:

Click to download the PDB-style file with coordinates for d1miva2.
(The format of our PDB-style files is described here.)

Timeline for d1miva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1miva1