Lineage for d1mi6a_ (1mi6 A:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 345888Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 345889Protein 70S ribosome functional complex [58121] (2 species)
  7. 345890Species Escherichia coli [TaxId:562] [58123] (21 PDB entries)
  8. 346031Domain d1mi6a_: 1mi6 A: [79149]
    Docking of the modified RF2 x-ray structure

Details for d1mi6a_

PDB Entry: 1mi6 (more details)

PDB Description: docking of the modified rf2 x-ray structure into the low resolution cryo-em map of rf2 e.coli 70s ribosome

SCOP Domain Sequences for d1mi6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi6a_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli}
inpvnnriqdltersdvlrgyldydakkerleevnaeleqpdvwneperaqalgkerssl
eavvdtldqmkqgledvsgllelaveaddeetfneavaeldaleeklaqlefrrmfsgey
dsadcyldiqagsggteaqdwasmlermylrwaesrgfkteiieesegevagiksvtiki
sgdyaygwlrtetgvhrlvrkspfdsggrrhtsfssafvypevdddidieinpadlridv
yrasgaggqhvnrtesavrithiptgivtqcqndrsqhknkdqamkqmkaklyevemqkk
naekqamednksdigwgsqirsyvlddsrikdlrtgvetrntqavldgsldqfieaslka
gl

SCOP Domain Coordinates for d1mi6a_:

Click to download the PDB-style file with coordinates for d1mi6a_.
(The format of our PDB-style files is described here.)

Timeline for d1mi6a_: